Name | Sialin/SLC17A5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59788 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC17A5 |
Conjugate | Unconjugated |
Supplier Page | Shop |