Sialin/SLC17A5 Antibody
| Name | Sialin/SLC17A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59788 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC17A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Sialin/SLC17A5 Antibody [NBP1-59788] - Titration: 0.5ug/ml Positive Control: 293T cells lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14487_Sialin-SLC17A5-Antibody-Western-Blot-NBP1-59788-img0003.jpg)
![Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP1-59788] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14488_Sialin-SLC17A5-Antibody-Immunohistochemistry-Paraffin-NBP1-59788-img0002.jpg)