HIC1 Antibody (4E11.)
| Name | HIC1 Antibody (4E11.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00003090-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 4E11. |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | HIC1 (NP_006488 396 a.a. - 453 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | HIC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11. Analysis of HIC1 expression in PC-12.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/27349_HIC1-Antibody-(4E11)-Western-Blot-H00003090-M01-img0008.jpg)
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11. Analysis of HIC1 expression in PC-12.
![Immunocytochemistry/Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/27350_HIC1-Antibody-(4E11)-Immunocytochemistry-Immunofluorescence-H00003090-M01-img0006.jpg)
Immunocytochemistry/Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.
![Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/27351_HIC1%2520Antibody%2520(4E11)-Western%2520Blot-H00003090-M01-img0009.jpg)
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.
![Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/27352_HIC1-Antibody-(4E11)-Sandwich-ELISA-H00003090-M01-img0007.jpg)
Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.