POU4F3 Antibody (5B8)

• Supplier: Novus Biologicals
• Catalog: H00005459-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 5B8
• Applications: WB ELISA ICC/IF Gene Silencing
• Species Reactivities: Human
• Antigen: POU4F3 (NP_002691, 100 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: POU4F3
• Conjugate: Unconjugated

Product images

Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - POU4F3 monoclonal antibody (M01), clone 5B8 Analysis of POU4F3 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of monoclonal antibody to POU4F3 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody (M01), clone 5B8.Lane 1: POU4F3 transfected lysate(37.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: POU4F3 Antibody (5B8) [H00005459-M01] - Detection limit for recombinant GST tagged POU4F3 is approximately 0.1ng/ml as a capture antibody.