HIC1 Antibody (2F9)

• Supplier: Novus Biologicals
• Catalog: H00003090-M02
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b Kappa
• Clone: 2F9
• Applications: WB ELISA ICC/IF
• Species Reactivities: Human, Rat
• Antigen: HIC1 (NP_006488 396 a.a. - 453 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: HIC1
• Conjugate: Unconjugated