RED1 Antibody
| Name | RED1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90240 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RED1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADARB1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RED1 Antibody [NBP1-90240] - Analysis in human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21069_RED1%2520Antibody-Western%2520Blot-NBP1-90240-img0009.jpg)
Western Blot: RED1 Antibody [NBP1-90240] - Analysis in human cell line U-251 MG.
![Immunohistochemistry-Paraffin: RED1 Antibody [NBP1-90240] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21070_RED1-Antibody-Immunohistochemistry-Paraffin-NBP1-90240-img0001.jpg)
Immunohistochemistry-Paraffin: RED1 Antibody [NBP1-90240] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of RT-4, U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21071_RED1-Antibody-Simple-Western-NBP1-90240-img0006.jpg)
Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of RT-4, U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21072_RED1-Antibody-Simple-Western-NBP1-90240-img0007.jpg)
Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: RED1 Antibody [NBP1-90240] - Electropherogram image(s) of corresponding Simple Western lane view. RED1 antibody was used at 1:20 dilution on RT-4 lysates(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21073_RED1-Antibody-Simple-Western-NBP1-90240-img0008.jpg)
Simple Western: RED1 Antibody [NBP1-90240] - Electropherogram image(s) of corresponding Simple Western lane view. RED1 antibody was used at 1:20 dilution on RT-4 lysates(s).