EIF3B Antibody
| Name | EIF3B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38597 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EIF3B Protein |
| Description | Rabbit Polyclonal |
| Gene | EIF3B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EIF3B Antibody [NBP2-38597] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15737_EIF3B-Antibody-Western-Blot-NBP2-38597-img0003.jpg)
Western Blot: EIF3B Antibody [NBP2-38597] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: EIF3B Antibody [NBP2-38597] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15738_EIF3B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38597-img0004.jpg)
Immunocytochemistry/Immunofluorescence: EIF3B Antibody [NBP2-38597] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry: EIF3B Antibody [NBP2-38597] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15739_EIF3B-Antibody-Immunohistochemistry-NBP2-38597-img0002.jpg)
Immunohistochemistry: EIF3B Antibody [NBP2-38597] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.