EPLIN Antibody
| Name | EPLIN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38673 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EPLIN Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LIMA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EPLIN Antibody [NBP2-38673] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17222_EPLIN-Antibody-Western-Blot-NBP2-38673-img0003.jpg)
Western Blot: EPLIN Antibody [NBP2-38673] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP2-38673] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, actin filaments & focal adhesion sites.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17223_EPLIN%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38673-img0004.jpg)
Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP2-38673] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, actin filaments & focal adhesion sites.
![Immunohistochemistry: EPLIN Antibody [NBP2-38673] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17224_EPLIN-Antibody-Immunohistochemistry-NBP2-38673-img0002.jpg)
Immunohistochemistry: EPLIN Antibody [NBP2-38673] - Staining of human kidney shows strong membranous positivity in cells in tubules.