Importin alpha 3/KPNA4 Antibody

Name Importin alpha 3/KPNA4 Antibody
Supplier Novus Biologicals
Catalog NBP2-38541
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
Purity/Format Immunogen affinity purified
Blocking Peptide Importin alpha 3/KPNA4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene KPNA4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.