MCCC2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-38403
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: MCCC2 Protein
• Description: Rabbit Polyclonal
• Gene: MCCC2
• Conjugate: Unconjugated

Product images

Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38403] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry: MCCC2 Antibody [NBP2-38403] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4Lane 3: U-251 MG