BANF1 Antibody
| Name | BANF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38442 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BANF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BANF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25678_BANF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38442-img0004.jpg)
![Immunohistochemistry: BANF1 Antibody [NBP2-38442] - Staining of human cerebellum shows distinct nuclear membrane positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25679_BANF1-Antibody-Immunohistochemistry-NBP2-38442-img0002.jpg)