PDIA6 Antibody
| Name | PDIA6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38213 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PDIA6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PDIA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PDIA6 Antibody [NBP2-38213] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15012_PDIA6-Antibody-Western-Blot-NBP2-38213-img0003.jpg)
Western Blot: PDIA6 Antibody [NBP2-38213] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: PDIA6 Antibody [NBP2-38213] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15013_PDIA6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38213-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PDIA6 Antibody [NBP2-38213] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
![Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15014_PDIA6-Antibody-Immunohistochemistry-Paraffin-NBP2-38213-img0004.jpg)
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.