TAF8 Antibody
| Name | TAF8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38188 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TAF8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TAF8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TAF8 Antibody [NBP2-38188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17765_TAF8-Antibody-Western-Blot-NBP2-38188-img0003.jpg)
Western Blot: TAF8 Antibody [NBP2-38188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunocytochemistry/Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17766_TAF8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38188-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
![Immunohistochemistry: TAF8 Antibody [NBP2-38188] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17767_TAF8-Antibody-Immunohistochemistry-NBP2-38188-img0002.jpg)
Immunohistochemistry: TAF8 Antibody [NBP2-38188] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.