S5a/Angiocidin Antibody
| Name | S5a/Angiocidin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37888 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | S5a/Angiocidin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PSMD4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28721_S5a-Angiocidin-Antibody-Western-Blot-NBP2-37888-img0003.jpg)
Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28722_S5a-Angiocidin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37888-img0005.jpg)
Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28723_S5a-Angiocidin-Antibody-Immunohistochemistry-Paraffin-NBP2-37888-img0004.jpg)
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.