ZNF207 Antibody
| Name | ZNF207 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39010 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF207 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF207 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF207 Antibody [NBP2-39010] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16443_ZNF207%2520Antibody-Western%2520Blot-NBP2-39010-img0003.jpg)
Western Blot: ZNF207 Antibody [NBP2-39010] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4
Lane 3: U-251 MG
![Immunocytochemistry/Immunofluorescence: ZNF207 Antibody [NBP2-39010] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16444_ZNF207-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39010-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ZNF207 Antibody [NBP2-39010] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.
![Immunohistochemistry: ZNF207 Antibody [NBP2-39010] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16445_ZNF207-Antibody-Immunohistochemistry-NBP2-39010-img0002.jpg)
Immunohistochemistry: ZNF207 Antibody [NBP2-39010] - Staining of human rectum shows strong nuclear positivity in glandular cells.