PTPN14/PTPD2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-38712
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PTPN14/PTPD2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PTPN14
• Conjugate: Unconjugated

Product images

Western Blot: PTPN14/PTPD2 Antibody [NBP2-38712] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: PTPN14/PTPD2 Antibody [NBP2-38712] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.

Immunohistochemistry: PTPN14/PTPD2 Antibody [NBP2-38712] - Staining of human colon shows moderate membranous positivity in glandular cells.