SNRPC Antibody
| Name | SNRPC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38755 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SNRPC Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SNRPC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SNRPC Antibody [NBP2-38755] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14839_SNRPC-Antibody-Western-Blot-NBP2-38755-img0003.jpg)
Western Blot: SNRPC Antibody [NBP2-38755] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: SNRPC Antibody [NBP2-38755] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14840_SNRPC%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38755-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SNRPC Antibody [NBP2-38755] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
![Immunohistochemistry: SNRPC Antibody [NBP2-38755] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14841_SNRPC-Antibody-Immunohistochemistry-NBP2-38755-img0002.jpg)
Immunohistochemistry: SNRPC Antibody [NBP2-38755] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.