UBASH3B/STS1/Tula-2 Antibody
| Name | UBASH3B/STS1/Tula-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34053 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UBASH3B/STS1/Tula-2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UBASH3B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25674_UBASH3B-STS1-Tula-2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34053-img0010.jpg)
Immunocytochemistry/Immunofluorescence: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
![Immunohistochemistry-Paraffin: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Staining of human lymph node shows strong cytoplasmic positivity in germinal and non germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25675_UBASH3B-STS1-Tula-2-Antibody-Immunohistochemistry-Paraffin-NBP2-34053-img0006.jpg)
Immunohistochemistry-Paraffin: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Staining of human lymph node shows strong cytoplasmic positivity in germinal and non germinal center cells.