CLNS1A Antibody
| Name | CLNS1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33964 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CLNS1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLNS1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CLNS1A Antibody [NBP2-33964] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16958_CLNS1A-Antibody-Western-Blot-NBP2-33964-img0004.jpg)
Western Blot: CLNS1A Antibody [NBP2-33964] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: CLNS1A Antibody [NBP2-33964] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16959_CLNS1A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33964-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CLNS1A Antibody [NBP2-33964] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: CLNS1A Antibody [NBP2-33964] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16960_CLNS1A-Antibody-Immunohistochemistry-Paraffin-NBP2-33964-img0002.jpg)
Immunohistochemistry-Paraffin: CLNS1A Antibody [NBP2-33964] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.