MIA3 Antibody
| Name | MIA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33770 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MIA3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MIA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MIA3 Antibody [NBP2-33770] - Analysis in human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22345_MIA3-Antibody-Western-Blot-NBP2-33770-img0007.jpg)
Western Blot: MIA3 Antibody [NBP2-33770] - Analysis in human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-33770] - Immunofluorescent staining of human cell line A549 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22346_MIA3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33770-img0009.jpg)
Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-33770] - Immunofluorescent staining of human cell line A549 shows localization to vesicles.
![Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22347_MIA3-Antibody-Immunohistochemistry-Paraffin-NBP2-33770-img0008.jpg)
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
![Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22348_MIA3-Antibody-Immunohistochemistry-Paraffin-NBP2-33770-img0001.jpg)
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
![Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22349_MIA3-Antibody-Immunohistochemistry-Paraffin-NBP2-33770-img0002.jpg)
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of liver.
![Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of colorectal cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22350_MIA3-Antibody-Immunohistochemistry-Paraffin-NBP2-33770-img0003.jpg)
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-33770] - Staining of colorectal cancer.