P2Y12/P2RY12 Antibody
| Name | P2Y12/P2RY12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33870 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | P2Y12/P2RY12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | P2RY12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5134_P2Y12-P2RY12%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0006.jpg)
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.