Suppressor of Ty 4 homolog 1 Antibody
| Name | Suppressor of Ty 4 homolog 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31794 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Suppressor of Ty 4 homolog 1 Protein |
| Description | Rabbit Polyclonal |
| Gene | SUPT4H1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17016_Suppressor-of-Ty-4-homolog-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31794-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.
![Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - pancreatic cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17017_Suppressor-of-Ty-4-homolog-1-Antibody-Immunohistochemistry-NBP2-31794-img0009.jpg)
Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - pancreatic cancer
![Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17018_Suppressor-of-Ty-4-homolog-1-Antibody-Immunohistochemistry-NBP2-31794-img0002.jpg)
Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.
![Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17019_Suppressor-of-Ty-4-homolog-1-Antibody-Immunohistochemistry-NBP2-31794-img0007.jpg)
Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - liver