Suppressor of Ty 4 homolog 1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31794
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: EDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Suppressor of Ty 4 homolog 1 Protein
• Description: Rabbit Polyclonal
• Gene: SUPT4H1

Product images

Immunocytochemistry/Immunofluorescence: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.

Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - pancreatic cancer

Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.

Immunohistochemistry: Suppressor of Ty 4 homolog 1 Antibody [NBP2-31794] - liver