NOLA1 Antibody
| Name | NOLA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31742 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NOLA1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GAR1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17049_NOLA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31742-img0001.jpg)
Immunocytochemistry/Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
![Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17050_NOLA1-Antibody-Immunohistochemistry-NBP2-31742-img0009.jpg)
Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - liver cancer
![Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - Immunohistochemical staining of human colon shows strong nuclear positivity in glandular, endothelial and ganglion cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17051_NOLA1-Antibody-Immunohistochemistry-NBP2-31742-img0002.jpg)
Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - Immunohistochemical staining of human colon shows strong nuclear positivity in glandular, endothelial and ganglion cells.
![Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17052_NOLA1-Antibody-Immunohistochemistry-NBP2-31742-img0003.jpg)
Immunohistochemistry: NOLA1 Antibody [NBP2-31742] - liver
![Western Blot: NOLA1 Antibody [NBP2-31742] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23193_NOLA1-Antibody-Western-Blot-NBP2-31742-img0010.jpg)
Western Blot: NOLA1 Antibody [NBP2-31742] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Liver