SMC6L1 Antibody
| Name | SMC6L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33378 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SMC6L1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SMC6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SMC6L1 Antibody [NBP2-33378] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20125_SMC6L1-Antibody-Immunohistochemistry-NBP2-33378-img0002.jpg)
Immunohistochemistry: SMC6L1 Antibody [NBP2-33378] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.