POLR2C Antibody
| Name | POLR2C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80817 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POLR2C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POLR2C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29208_POLR2C-Antibody-Western-Blot-NBP1-80817-img0008.jpg)
Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29209_POLR2C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80817-img0011.jpg)
Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.
![Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29210_POLR2C-Antibody-Western-Blot-NBP1-80817-img0005.jpg)
Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29211_POLR2C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80817-img0010.jpg)
Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.