USP22 Antibody
| Name | USP22 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82941 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | USP22 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | USP22 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: USP22 Antibody [NBP1-82941] - Staining of human cell line U-251 MG shows localization to nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25501_USP22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82941-img0008.jpg)
Immunocytochemistry/Immunofluorescence: USP22 Antibody [NBP1-82941] - Staining of human cell line U-251 MG shows localization to nuclear speckles.
![Immunohistochemistry-Paraffin: USP22 Antibody [NBP1-82941] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25502_USP22-Antibody-Immunohistochemistry-Paraffin-NBP1-82941-img0009.jpg)
Immunohistochemistry-Paraffin: USP22 Antibody [NBP1-82941] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.