PNPLA8 Antibody
| Name | PNPLA8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83098 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PNPLA8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PNPLA8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21803_PNPLA8-Antibody-Western-Blot-NBP1-83098-img0006.jpg)
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
![Immunocytochemistry/Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21804_PNPLA8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83098-img0007.jpg)
Immunocytochemistry/Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.
![Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21805_PNPLA8-Antibody-Immunohistochemistry-Paraffin-NBP1-83098-img0002.jpg)
Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.