PLEKHF2 Antibody

Name	PLEKHF2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-82265
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN
Purity/Format	Immunogen affinity purified
Blocking Peptide	PLEKHF2 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	PLEKHF2
Supplier Page	Shop

Product images

Western Blot: PLEKHF2 Antibody [NBP1-82265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411203)

Western Blot: PLEKHF2 Antibody [NBP1-82265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411203)

Immunocytochemistry/Immunofluorescence: PLEKHF2 Antibody [NBP1-82265] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.

Immunohistochemistry-Paraffin: PLEKHF2 Antibody [NBP1-82265] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.