CDCA7 Antibody
| Name | CDCA7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82224 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CDCA7 Protein |
| Description | Rabbit Polyclonal |
| Gene | CDCA7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21109_CDCA7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82224-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: CDCA7 Antibody [NBP1-82224] - Staining of human stomach shows strong cytoplasmic positivity in granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21110_CDCA7-Antibody-Immunohistochemistry-Paraffin-NBP1-82224-img0002.jpg)
Immunohistochemistry-Paraffin: CDCA7 Antibody [NBP1-82224] - Staining of human stomach shows strong cytoplasmic positivity in granular pattern in glandular cells.
![Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21111_CDCA7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82224-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
![Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human lymph node shows strong nuclear and cytoplasmic positivity in germinal and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21112_CDCA7%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82224-img0006.jpg)
Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human lymph node shows strong nuclear and cytoplasmic positivity in germinal and non-germinal center cells.