Exosome component 10 Antibody
| Name | Exosome component 10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82448 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Exosome component 10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EXOSC10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6466_Exosome-component-10-Antibody-Western-Blot-NBP1-82448-img0006.jpg)
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human esophagus shows strong nucleolar positivity in superficial squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6468_Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0002.jpg)