Nuclear Factor Erythroid Derived 2 Antibody
| Name | Nuclear Factor Erythroid Derived 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82580 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Nuclear Factor Erythroid Derived 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NFE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HELA.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21975_Nuclear-Factor-Erythroid-Derived-2-Antibody-Western-Blot-NBP1-82580-img0009.jpg)
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HELA.
![Immunocytochemistry/Immunofluorescence: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoskeleton (actin filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21976_Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82580-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoskeleton (actin filaments).
![Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21977_Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82580-img0008.jpg)
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
![Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21978_Nuclear-Factor-Erythroid-Derived-2-Antibody-Simple-Western-NBP1-82580-img0006.jpg)
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21979_Nuclear-Factor-Erythroid-Derived-2-Antibody-Simple-Western-NBP1-82580-img0007.jpg)
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).