NIPA Antibody
| Name | NIPA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82564 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NIPA Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZC3HC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NIPA Antibody [NBP1-82564] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21516_NIPA-Antibody-Western-Blot-NBP1-82564-img0007.jpg)
Western Blot: NIPA Antibody [NBP1-82564] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunocytochemistry/Immunofluorescence: NIPA Antibody [NBP1-82564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21517_NIPA%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82564-img0008.jpg)
Immunocytochemistry/Immunofluorescence: NIPA Antibody [NBP1-82564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.
![Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82564] - Staining of human hippocampus shows strong nuclear and nuclear membranous positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21518_NIPA-Antibody-Immunohistochemistry-Paraffin-NBP1-82564-img0006.jpg)
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82564] - Staining of human hippocampus shows strong nuclear and nuclear membranous positivity in neuronal cells.
![Western Blot: NIPA Antibody [NBP1-82564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-385](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21519_NIPA-Antibody-Western-Blot-NBP1-82564-img0005.jpg)
Western Blot: NIPA Antibody [NBP1-82564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-385
![Immunocytochemistry/Immunofluorescence: NIPA Antibody [NBP1-82564] - Staining of human cell line U-251 MG shows positivity in nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21520_NIPA-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82564-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NIPA Antibody [NBP1-82564] - Staining of human cell line U-251 MG shows positivity in nuclear membrane.