KPNA6 Antibody

Name KPNA6 Antibody
Supplier Novus Biologicals
Catalog NBP1-83762
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Purity/Format Immunogen affinity purified
Blocking Peptide KPNA6 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene KPNA6
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.