NUDT15 Antibody
| Name | NUDT15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83800 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAALHLKNVHFASVVNSFI |
| Description | Rabbit Polyclonal |
| Gene | NUDT15 |
| Supplier Page | Shop |
Product images
![Western Blot: NUDT15 Antibody [NBP1-83800] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18540_NUDT15%2520Antibody-Western%2520Blot-NBP1-83800-img0005.jpg)
Western Blot: NUDT15 Antibody [NBP1-83800] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: NUDT15 Antibody [NBP1-83800] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18541_NUDT15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83800-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NUDT15 Antibody [NBP1-83800] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: NUDT15 Antibody [NBP1-83800] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18542_NUDT15-Antibody-Immunohistochemistry-Paraffin-NBP1-83800-img0002.jpg)
Immunohistochemistry-Paraffin: NUDT15 Antibody [NBP1-83800] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.