HOOK3 Antibody
| Name | HOOK3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81743 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HOOK3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOOK3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HOOK3 Antibody [NBP1-81743] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26574_HOOK3%2520Antibody-Western%2520Blot-NBP1-81743-img0005.jpg)
Western Blot: HOOK3 Antibody [NBP1-81743] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: HOOK3 Antibody [NBP1-81743] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26575_HOOK3-Antibody-Immunohistochemistry-Paraffin-NBP1-81743-img0002.jpg)
Immunohistochemistry-Paraffin: HOOK3 Antibody [NBP1-81743] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.