FKRP Antibody
| Name | FKRP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32543 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FKRP Protein |
| Description | Rabbit Polyclonal |
| Gene | FKRP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FKRP Antibody [NBP2-32543] - Analysis in human plasma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15890_FKRP%2520Antibody-Western%2520Blot-NBP2-32543-img0005.jpg)
Western Blot: FKRP Antibody [NBP2-32543] - Analysis in human plasma.
![Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15891_FKRP-Antibody-Immunohistochemistry-Paraffin-NBP2-32543-img0008.jpg)
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of liver cancer.
![Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15892_FKRP-Antibody-Immunohistochemistry-Paraffin-NBP2-32543-img0006.jpg)
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
![Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of Skeletal muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15893_FKRP-Antibody-Immunohistochemistry-Paraffin-NBP2-32543-img0007.jpg)
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of Skeletal muscle.