CTDSPL Antibody
| Name | CTDSPL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31913 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CTDSPL Protein |
| Description | Rabbit Polyclonal |
| Gene | CTDSPL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CTDSPL Antibody [NBP2-31913] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10647_CTDSPL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31913-img0007.jpg)
![Immunohistochemistry: CTDSPL Antibody [NBP2-31913] - Staining of human lung shows moderate membranous positivity in pneumocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10648_CTDSPL-Antibody-Immunohistochemistry-NBP2-31913-img0004.jpg)