Vang-like Protein 1/VANGL1 Antibody
| Name | Vang-like Protein 1/VANGL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86990 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Vang-like Protein 1/VANGL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VANGL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in human cell line MCF-7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6343_Vang-like-Protein-1-VANGL1-Antibody-Western-Blot-NBP1-86990-img0011.jpg)
Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in human cell line MCF-7.
![Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6344_Vang-like-Protein-1-VANGL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86990-img0010.jpg)
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.
![Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6345_Vang-like-Protein-1-VANGL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86990-img0007.jpg)
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells.
![Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human small intestine shows strong positivity in apical membrane in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6346_Vang-like-Protein-1-VANGL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86990-img0008.jpg)
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human small intestine shows strong positivity in apical membrane in glandular cells.
![Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6347_Vang-like-Protein-1-VANGL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86990-img0009.jpg)
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.