Shwachman Bodian-Diamond syndrome Antibody
| Name | Shwachman Bodian-Diamond syndrome Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87070 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Shwachman Bodian-Diamond syndrome Protein |
| Description | Rabbit Polyclonal |
| Gene | SBDS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14904_Shwachman-Bodian-Diamond-syndrome-Antibody-Western-Blot-NBP1-87070-img0005.jpg)
Western Blot: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14905_Shwachman%2520Bodian-Diamond%2520syndrome%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87070-img0006.jpg)
Immunocytochemistry/Immunofluorescence: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
![Immunohistochemistry-Paraffin: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14906_Shwachman-Bodian-Diamond-syndrome-Antibody-Immunohistochemistry-Paraffin-NBP1-87070-img0002.jpg)
Immunohistochemistry-Paraffin: Shwachman Bodian-Diamond syndrome Antibody [NBP1-87070] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.