PTPRH Antibody
| Name | PTPRH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87091 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTS |
| Description | Rabbit Polyclonal |
| Gene | PTPRH |
| Supplier Page | Shop |
Product images
![Western Blot: PTPRH Antibody [NBP1-87091] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19999_PTPRH%2520Antibody-Western%2520Blot-NBP1-87091-img0005.jpg)
Western Blot: PTPRH Antibody [NBP1-87091] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: PTPRH Antibody [NBP1-87091] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20000_PTPRH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87091-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PTPRH Antibody [NBP1-87091] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & mitochondria.
![Immunohistochemistry-Paraffin: PTPRH Antibody [NBP1-87091] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20001_PTPRH-Antibody-Immunohistochemistry-Paraffin-NBP1-87091-img0002.jpg)
Immunohistochemistry-Paraffin: PTPRH Antibody [NBP1-87091] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.