Glycerol 3 Phosphate Dehydrogenase Antibody

Name Glycerol 3 Phosphate Dehydrogenase Antibody
Supplier Novus Biologicals
Catalog NBP1-87411
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
Purity/Format Immunogen affinity purified
Blocking Peptide Glycerol 3 Phosphate Dehydrogenase Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GPD1L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.