HMGCLL1 Antibody
| Name | HMGCLL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88768 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIVEVGPRDGLQNEKVIVPTDI |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HMGCLL1 |
| Supplier Page | Shop |
Product images
![Western Blot: HMGCLL1 Antibody [NBP1-88768] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21332_HMGCLL1-Antibody-Western-Blot-NBP1-88768-img0006.jpg)
Western Blot: HMGCLL1 Antibody [NBP1-88768] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: HMGCLL1 Antibody [NBP1-88768] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21333_HMGCLL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88768-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HMGCLL1 Antibody [NBP1-88768] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: HMGCLL1 Antibody [NBP1-88768] - Immunohistochemical staining of human pancreas shows strong nuclear and cytoplasmic positivity in islet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21334_HMGCLL1-Antibody-Immunohistochemistry-Paraffin-NBP1-88768-img0001.jpg)
Immunohistochemistry-Paraffin: HMGCLL1 Antibody [NBP1-88768] - Immunohistochemical staining of human pancreas shows strong nuclear and cytoplasmic positivity in islet cells.