HSCB Antibody
| Name | HSCB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84066 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HSCB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HSCB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HSCB Antibody [NBP1-84066] - Analysis in control (vector only transfected HEK293T lysate) and hSCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6527_HSCB-Antibody-Western-Blot-NBP1-84066-img0006.jpg)
Western Blot: HSCB Antibody [NBP1-84066] - Analysis in control (vector only transfected HEK293T lysate) and hSCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: HSCB Antibody [NBP1-84066] - Staining of human cell line U-251MG shows positivity in plasma membrane, cytoplasm and centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6528_HSCB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84066-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HSCB Antibody [NBP1-84066] - Staining of human cell line U-251MG shows positivity in plasma membrane, cytoplasm and centrosome.
![Immunohistochemistry-Paraffin: HSCB Antibody [NBP1-84066] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6529_HSCB-Antibody-Immunohistochemistry-Paraffin-NBP1-84066-img0001.jpg)
Immunohistochemistry-Paraffin: HSCB Antibody [NBP1-84066] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.