PHACTR1 Antibody
| Name | PHACTR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84232 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PCSTSYHSSGLHSGDGVTKAGPMGLPEIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PHACTR1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PHACTR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PHACTR1 Antibody [NBP1-84232] - Analysis in human cerebral cortex tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25773_PHACTR1-Antibody-Western-Blot-NBP1-84232-img0006.jpg)
![Immunohistochemistry-Paraffin: PHACTR1 Antibody [NBP1-84232] - Staining of human lateral ventricle shows strong positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25774_PHACTR1-Antibody-Immunohistochemistry-Paraffin-NBP1-84232-img0002.jpg)