SIGLECL1 Antibody
| Name | SIGLECL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14794 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRIL E |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SIGLECL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SIGLEC12 |
| Supplier Page | Shop |
Product images
![Western Blot: SIGLEC1 Antibody [NBP2-14794] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406523)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22155_SIGLEC1%2520Antibody-Western%2520Blot-NBP2-14794-img0004.jpg)
Western Blot: SIGLEC1 Antibody [NBP2-14794] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406523)
![Immunocytochemistry/Immunofluorescence: SIGLEC1 Antibody [NBP2-14794] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22156_SIGLEC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14794-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SIGLEC1 Antibody [NBP2-14794] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: SIGLEC1 Antibody [NBP2-14794] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22157_SIGLEC1-Antibody-Immunohistochemistry-Paraffin-NBP2-14794-img0001.jpg)
Immunohistochemistry-Paraffin: SIGLEC1 Antibody [NBP2-14794] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.