DCUN1D1 Antibody

Name DCUN1D1 Antibody
Supplier Novus Biologicals
Catalog NBP1-85275
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Purity/Format Immunogen affinity purified
Blocking Peptide DCUN1D1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene DCUN1D1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.