NOX1 Antibody
| Name | NOX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83347 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHP |
| Blocking Peptide | NOX1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NOX1 |
| Supplier Page | Shop |
Product images
![Western Blot: NOX1 Antibody [NBP1-83347] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22377_NOX1-Antibody-Western-Blot-NBP1-83347-img0005.jpg)
Western Blot: NOX1 Antibody [NBP1-83347] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: NOX1 Antibody [NBP1-83347] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22378_NOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-83347-img0002.jpg)
Immunohistochemistry-Paraffin: NOX1 Antibody [NBP1-83347] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.