NCKAP1 Antibody
| Name | NCKAP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83269 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NCKAP1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NCKAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NCKAP1 Antibody [NBP1-83269] - Analysis in control (vector only transfected HEK293T lysate) and nCKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21562_NCKAP1-Antibody-Western-Blot-NBP1-83269-img0005.jpg)
Western Blot: NCKAP1 Antibody [NBP1-83269] - Analysis in control (vector only transfected HEK293T lysate) and nCKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21563_NCKAP1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83269-img0006.jpg)
Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21564_NCKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83269-img0002.jpg)
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.