UNC45A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-13506
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids: QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAA ACLDKAVEYGLIQPNQDG
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: UNC45A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: UNC45A
• Conjugate: Unconjugated

Product images

Western Blot: UNC45A Antibody [NBP2-13506] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: UNC45A Antibody [NBP2-13506] - Staining of human cell line HEK 293 shows positivity in cytoplasm and golgi apparatus.

Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.