ZRANB3 Antibody
| Name | ZRANB3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13604 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VEGWQCSLCTYINNSELPYCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQ KDTSKKVQTISDCEKQALAQSEPGQLADSKEETPKIEKEDGLT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZRANB3 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZRANB3 |
| Supplier Page | Shop |
Product images
![Western Blot: ZRANB3 Antibody [NBP2-13604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23392_ZRANB3-Antibody-Western-Blot-NBP2-13604-img0005.jpg)
Western Blot: ZRANB3 Antibody [NBP2-13604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
![Immunocytochemistry/Immunofluorescence: ZRANB3 Antibody [NBP2-13604] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23393_ZRANB3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13604-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZRANB3 Antibody [NBP2-13604] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & golgi apparatus.
![Immunohistochemistry-Paraffin: ZRANB3 Antibody [NBP2-13604] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23394_ZRANB3-Antibody-Immunohistochemistry-Paraffin-NBP2-13604-img0001.jpg)
Immunohistochemistry-Paraffin: ZRANB3 Antibody [NBP2-13604] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.